Crystal structure of the ing5 phd finger in complex with h3k4me3 peptide
PDB DOI: 10.2210/pdb3c6w/pdb
Classification: METAL BINDING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2008-02-05 Deposition Author(s): Champagne, K.S. , Johnson, K. , Kutateladze, T.G. , Pena, P.V.
Crystal structure of the ing5 phd finger in complex with h3k4me3 peptide
Champagne, K.S. , Johnson, K. , Kutateladze, T.G. , Pena, P.V.
Primary Citation of Related Structures: 3C6W
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Inhibitor of growth protein 5 | A | 59 | Homo Sapiens , Synthetic Construct | LVCRGSNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEK |
Inhibitor of growth protein 5 | C | 59 | Homo Sapiens , Synthetic Construct | LVCRGSNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEK |
H3K4me3 histone peptide | B | 12 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTG |
H3K4me3 histone peptide | D | 12 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTG |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-02-05 Deposition Author(s): Champagne, K.S. , Johnson, K. , Kutateladze, T.G. , Pena, P.V.