3C6W
Crystal structure of the ing5 phd finger in complex with h3k4me3 peptide
PDB DOI: 10.2210/pdb3c6w/pdb
Classification: METAL BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2008-02-05 Deposition Author(s): Champagne, K.S. , Johnson, K. , Kutateladze, T.G. , Pena, P.V.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.75 Å
Crystal structure of the ing5 phd finger in complex with h3k4me3 peptide
Champagne, K.S. , Johnson, K. , Kutateladze, T.G. , Pena, P.V.
Primary Citation of Related Structures: 3C6W
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Inhibitor of growth protein 5 | A | 59 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | LVCRGSNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEK |
| Inhibitor of growth protein 5 | C | 59 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | LVCRGSNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEK |
| H3K4me3 histone peptide | B | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKSTG |
| H3K4me3 histone peptide | D | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKSTG |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2008-02-05 Deposition Author(s): Champagne, K.S. , Johnson, K. , Kutateladze, T.G. , Pena, P.V.