Crystal structure of acostatin from agkistrodon contortrix contortrix
PDB DOI: 10.2210/pdb3c05/pdb
Classification: BLOOD CLOTTING/ANTITUMOR PROTEIN Organism(s): Agkistrodon Contortrix Contortrix
Deposited: 2008-01-18 Deposition Author(s): Allaire, M. , Bau, R. , Moiseeva, N.
Crystal structure of acostatin from agkistrodon contortrix contortrix
Allaire, M. , Bau, R. , Moiseeva, N.
Primary Citation of Related Structures: 3C05
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Disintegrin acostatin alpha | A | 62 | Agkistrodon Contortrix Contortrix | QPKNPCCDAATCKLTPGSQCAEGLCCDQCKFIKAGKICRRARGDNPDYRCTGQSGDCPRKHF |
Disintegrin acostatin alpha | C | 62 | Agkistrodon Contortrix Contortrix | QPKNPCCDAATCKLTPGSQCAEGLCCDQCKFIKAGKICRRARGDNPDYRCTGQSGDCPRKHF |
Disintegrin acostatin-beta | B | 64 | Agkistrodon Contortrix Contortrix | DAPANPCCDAATCKLTTGSQCADGLCCDQCKFMKEGTVCRRARGDDLDDYCNGISAGCPRNPFH |
Disintegrin acostatin-beta | D | 64 | Agkistrodon Contortrix Contortrix | DAPANPCCDAATCKLTTGSQCADGLCCDQCKFMKEGTVCRRARGDDLDDYCNGISAGCPRNPFH |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-01-18 Deposition Author(s): Allaire, M. , Bau, R. , Moiseeva, N.