Crystal structure of the 3rd pdz domain of human membrane associated guanylate kinase, c677s and c709s double mutant
PDB DOI: 10.2210/pdb3bpu/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica
Deposited: 2007-12-19 Deposition Author(s): Arrowsmith, C.H. , Cooper, C. , Doyle, D.A. , Edwards, A.M. , Elkins, J. , Hozjan, V. , Oppermann, U. , Pike, A.C.W. , Pilka, E.S. , Structural Genomics Consortium (Sgc) , Von Delft, F. , Weigelt, J.
Crystal structure of the 3rd pdz domain of human membrane associated guanylate kinase, c677s and c709s double mutant
Arrowsmith, C.H. , Cooper, C. , Doyle, D.A. , Edwards, A.M. , Elkins, J. , Hozjan, V. , Oppermann, U. , Pike, A.C.W. , Pilka, E.S. , Structural Genomics Consortium (Sgc) , Von Delft, F. , Weigelt, J.
Primary Citation of Related Structures: 3BPU
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 | A | 88 | Salmonella Enterica | SMELITVHIVKGPMGFGFTIADSPGGGGQRVKQIVDSPRSRGLKEGDLIVEVNKKNVQALTHNQVVDMLVESPKGSEVTLLVQRQTRL |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-12-19 Deposition Author(s): Arrowsmith, C.H. , Cooper, C. , Doyle, D.A. , Edwards, A.M. , Elkins, J. , Hozjan, V. , Oppermann, U. , Pike, A.C.W. , Pilka, E.S. , Structural Genomics Consortium (Sgc) , Von Delft, F. , Weigelt, J.