Crystal structure of a putative tetr-family transcriptional regulator (mlr_4833) from mesorhizobium loti maff303099 at 1.54 a resolution
PDB DOI: 10.2210/pdb3bhq/pdb
Classification: TRANSCRIPTION Organism(s): Mesorhizobium Loti
Deposited: 2007-11-28 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)
Crystal structure of a putative tetr-family transcriptional regulator (mlr_4833) from mesorhizobium loti maff303099 at 1.54 a resolution
Joint Center For Structural Genomics (Jcsg)
Primary Citation of Related Structures: 3BHQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcriptional regulator | A | 211 | Mesorhizobium Loti | GMKIDGETRSARKDREIIQAATAAFISKGYDGTSMEEIATKAGASKQTVYKHFTDKETLFGEVVLSTASQVNDIIESVTTLLSEAIFMEGGLQQLARRLIAVLMDEELLKLRRLIIANADRMPQLGRAWYEKGFERMLASTASCFQKLTNRGLIQTGDPYLAASHLFGMLLWIPMNEAMFTGSNRRSKAELERHADASVEAFLAVYGVQPK |
| Transcriptional regulator | B | 211 | Mesorhizobium Loti | GMKIDGETRSARKDREIIQAATAAFISKGYDGTSMEEIATKAGASKQTVYKHFTDKETLFGEVVLSTASQVNDIIESVTTLLSEAIFMEGGLQQLARRLIAVLMDEELLKLRRLIIANADRMPQLGRAWYEKGFERMLASTASCFQKLTNRGLIQTGDPYLAASHLFGMLLWIPMNEAMFTGSNRRSKAELERHADASVEAFLAVYGVQPK |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-11-28 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)