Crystal structure of ig-like c2-type 2 domain of the human mucosa-associated lymphoid tissue lymphoma translocation protein 1
PDB DOI: 10.2210/pdb3bfo/pdb
Classification: HYDROLASE Organism(s): Salmonella Enterica
Deposited: 2007-11-22 Deposition Author(s): Akutsu, M. , Arrowsmith, C.H. , Bochkarev, A. , Dhe-Paganon, S. , Edwards, A.M. , Li, Y. , Littler, D.R. , Structural Genomics Consortium (Sgc) , Walker, J.R. , Weigelt, J.
Crystal structure of ig-like c2-type 2 domain of the human mucosa-associated lymphoid tissue lymphoma translocation protein 1
Akutsu, M. , Arrowsmith, C.H. , Bochkarev, A. , Dhe-Paganon, S. , Edwards, A.M. , Li, Y. , Littler, D.R. , Structural Genomics Consortium (Sgc) , Walker, J.R. , Weigelt, J.
Primary Citation of Related Structures: 3BFO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (Isoform 2) | A | 91 | Salmonella Enterica | GSKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKKVEIIIDELNNL |
Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (Isoform 2) | B | 91 | Salmonella Enterica | GSKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKKVEIIIDELNNL |
Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (Isoform 2) | C | 91 | Salmonella Enterica | GSKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKKVEIIIDELNNL |
Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (Isoform 2) | D | 91 | Salmonella Enterica | GSKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKKVEIIIDELNNL |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-11-22 Deposition Author(s): Akutsu, M. , Arrowsmith, C.H. , Bochkarev, A. , Dhe-Paganon, S. , Edwards, A.M. , Li, Y. , Littler, D.R. , Structural Genomics Consortium (Sgc) , Walker, J.R. , Weigelt, J.