Crystal structure of the n-terminal region of the scallop myosin rod, monoclinic (c2) form
PDB DOI: 10.2210/pdb3bas/pdb
Classification: CONTRACTILE PROTEIN Organism(s): Argopecten Irradians , Saccharomyces Cerevisiae
Deposited: 2007-11-08 Deposition Author(s): Brown, J.H. , Cohen, C.
Crystal structure of the n-terminal region of the scallop myosin rod, monoclinic (c2) form
Primary Citation of Related Structures: 3BAS
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Myosin heavy chain, striated muscle/General control protein GCN4 chimera | A | 89 | Argopecten Irradians , Saccharomyces Cerevisiae | GSHMPLLSIARQEEEMKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFGSMKQLEDKVEELLSKNYHLENEVARLKKLVGER |
Myosin heavy chain, striated muscle/General control protein GCN4 chimera | B | 89 | Argopecten Irradians , Saccharomyces Cerevisiae | GSHMPLLSIARQEEEMKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFGSMKQLEDKVEELLSKNYHLENEVARLKKLVGER |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-11-08 Deposition Author(s): Brown, J.H. , Cohen, C.