Crystal structure of the third pdz domain of human ligand-of-numb protein-x (lnx1) in complex with the c-terminal peptide from the coxsackievirus and adenovirus receptor
PDB DOI: 10.2210/pdb3b76/pdb
Classification: LIGASE Organism(s): Homo Sapiens
Deposited: 2007-10-30 Deposition Author(s): Arrowsmith, C.H. , Berridge, G. , Bunkoczi, G. , Burgess-Brown, N. , Doyle, D. , Edwards, A.M. , Elkins, J. , Gileadi, O. , Pike, A.C.W. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Ugochukwu, E. , Von Delft, F. , Weigelt, J.
Crystal structure of the third pdz domain of human ligand-of-numb protein-x (lnx1) in complex with the c-terminal peptide from the coxsackievirus and adenovirus receptor
Arrowsmith, C.H. , Berridge, G. , Bunkoczi, G. , Burgess-Brown, N. , Doyle, D. , Edwards, A.M. , Elkins, J. , Gileadi, O. , Pike, A.C.W. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Ugochukwu, E. , Von Delft, F. , Weigelt, J.
Primary Citation of Related Structures: 3B76
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase LNX | A | 118 | Homo Sapiens | MHHHHHHSSGVDLGTENLYFQSMHEKVVNIQKDPGESLGMTVAGGASHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVALLKRTSSSIVLKALEVKEGSIV |
| E3 ubiquitin-protein ligase LNX | B | 118 | Homo Sapiens | MHHHHHHSSGVDLGTENLYFQSMHEKVVNIQKDPGESLGMTVAGGASHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVALLKRTSSSIVLKALEVKEGSIV |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-10-30 Deposition Author(s): Arrowsmith, C.H. , Berridge, G. , Bunkoczi, G. , Burgess-Brown, N. , Doyle, D. , Edwards, A.M. , Elkins, J. , Gileadi, O. , Pike, A.C.W. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Ugochukwu, E. , Von Delft, F. , Weigelt, J.