Crystal structure of the human vitamin d receptor ligand binding domain complexed with 15alpha-methoxy-1alpha,25-dihydroxyvitamin d3
PDB DOI: 10.2210/pdb3ax8/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2011-03-30 Deposition Author(s): Kakuda, S. , Takimoto-Kamimura, M.
Crystal structure of the human vitamin d receptor ligand binding domain complexed with 15alpha-methoxy-1alpha,25-dihydroxyvitamin d3
Kakuda, S. , Takimoto-Kamimura, M.
Primary Citation of Related Structures: 3AX8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Vitamin D3 receptor | A | 263 | Homo Sapiens | GSHMDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFGNEIS |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-03-30 Deposition Author(s): Kakuda, S. , Takimoto-Kamimura, M.