Crystal structure of rat tom20-aldh presequence complex: a complex (form2) between tom20 and a disulfide-bridged presequence peptide containing d-cys and l-cys at the i and i+3 positions.
PDB DOI: 10.2210/pdb3ax3/pdb
Classification: MEMBRANE PROTEIN/TRANSPORT PROTEIN Organism(s): Rattus Norvegicus , Synthetic Construct
Deposited: 2011-03-28 Deposition Author(s): Kohda, D. , Maita, Y. , Saitoh, T.
Crystal structure of rat tom20-aldh presequence complex: a complex (form2) between tom20 and a disulfide-bridged presequence peptide containing d-cys and l-cys at the i and i+3 positions.
Kohda, D. , Maita, Y. , Saitoh, T.
Primary Citation of Related Structures: 3AX3
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Mitochondrial import receptor subunit TOM20 homolog | A | 73 | Rattus Norvegicus , Synthetic Construct | GPLGSDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVSGQPQQLLQVLQQTLPPPVFQMLLTKL |
Mitochondrial import receptor subunit TOM20 homolog | C | 73 | Rattus Norvegicus , Synthetic Construct | GPLGSDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVSGQPQQLLQVLQQTLPPPVFQMLLTKL |
Mitochondrial import receptor subunit TOM20 homolog | E | 73 | Rattus Norvegicus , Synthetic Construct | GPLGSDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVSGQPQQLLQVLQQTLPPPVFQMLLTKL |
Mitochondrial import receptor subunit TOM20 homolog | G | 73 | Rattus Norvegicus , Synthetic Construct | GPLGSDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVSGQPQQLLQVLQQTLPPPVFQMLLTKL |
Aldehyde dehydrogenase, mitochondrial | B | 12 | Rattus Norvegicus , Synthetic Construct | GCRLCRLLSYAX |
Aldehyde dehydrogenase, mitochondrial | D | 12 | Rattus Norvegicus , Synthetic Construct | GCRLCRLLSYAX |
Aldehyde dehydrogenase, mitochondrial | F | 12 | Rattus Norvegicus , Synthetic Construct | GCRLCRLLSYAX |
Aldehyde dehydrogenase, mitochondrial | H | 12 | Rattus Norvegicus , Synthetic Construct | GCRLCRLLSYAX |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-03-28 Deposition Author(s): Kohda, D. , Maita, Y. , Saitoh, T.