3AHA
Crystal structure of the complex between gp41 fragments n36 and c34 mutant n126k/e137q
PDB DOI: 10.2210/pdb3aha/pdb
Classification: MEMBRANE PROTEIN Organism(s): Human Immunodeficiency Virus 1
Deposited: 2010-04-22 Deposition Author(s): Fujii, N. , Izumi, K. , Kobayashi, Y. , Kodama, E.N. , Matsuoka, M. , Nakamura, S. , Nakano, H. , Ohkubo, T. , Oishi, S. , Sakagami, Y. , Shimura, K. , Uchiyama, S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Crystal structure of the complex between gp41 fragments n36 and c34 mutant n126k/e137q
Fujii, N. , Izumi, K. , Kobayashi, Y. , Kodama, E.N. , Matsuoka, M. , Nakamura, S. , Nakano, H. , Ohkubo, T. , Oishi, S. , Sakagami, Y. , Shimura, K. , Uchiyama, S.
Primary Citation of Related Structures: 3AHA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transmembrane protein gp41 | A | 38 | Human Immunodeficiency Virus 1 | XSDIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILX |
| Transmembrane protein gp41 | C | 38 | Human Immunodeficiency Virus 1 | XSDIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILX |
| Transmembrane protein gp41 | E | 38 | Human Immunodeficiency Virus 1 | XSDIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILX |
| Transmembrane protein gp41 | B | 36 | Human Immunodeficiency Virus 1 | XWMEWDREINKYTSLIHSLIEQSQNQQEKNEQELLX |
| Transmembrane protein gp41 | D | 36 | Human Immunodeficiency Virus 1 | XWMEWDREINKYTSLIHSLIEQSQNQQEKNEQELLX |
| Transmembrane protein gp41 | F | 36 | Human Immunodeficiency Virus 1 | XWMEWDREINKYTSLIHSLIEQSQNQQEKNEQELLX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2010-04-22 Deposition Author(s): Fujii, N. , Izumi, K. , Kobayashi, Y. , Kodama, E.N. , Matsuoka, M. , Nakamura, S. , Nakano, H. , Ohkubo, T. , Oishi, S. , Sakagami, Y. , Shimura, K. , Uchiyama, S.