Structure of cytochrome c551 from p. aeruginosa refined at 1.6 angstroms resolution and comparison of the two redox forms
PDB DOI: 10.2210/pdb351c/pdb
Classification: ELECTRON TRANSPORT Organism(s): Pseudomonas Aeruginosa
Deposited: 1981-07-20 Deposition Author(s): Dickerson, R.E. , Matsuura, Y. , Takano, T.
Structure of cytochrome c551 from p. aeruginosa refined at 1.6 angstroms resolution and comparison of the two redox forms
Dickerson, R.E. , Matsuura, Y. , Takano, T.
Primary Citation of Related Structures: 351C
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CYTOCHROME C551 | A | 82 | Pseudomonas Aeruginosa | EDPEVLFKNKGCVACHAIDTKMVGPAYKDVAAKFAGQAGAEAELAQRIKNGSQGVWGPIPMPPNAVSDDEAQTLAKWVLSQK |
Method: X-RAY DIFFRACTION
Deposited Date: 1981-07-20 Deposition Author(s): Dickerson, R.E. , Matsuura, Y. , Takano, T.