2ZPP
Neutron crystal structure of cubic insulin at pd9
PDB DOI: 10.2210/pdb2zpp/pdb
Classification: HORMONE Organism(s): Sus Scrofa
Deposited: 2008-07-26 Deposition Author(s): Ishikawa, T. , Niimura, N. , Tanaka, I.
Experimental Data Snapshot
Method: NEUTRON DIFFRACTION Resolution: 2.5 Å
Neutron crystal structure of cubic insulin at pd9
Ishikawa, T. , Niimura, N. , Tanaka, I.
Primary Citation of Related Structures: 2ZPP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin A chain | A | 21 | Sus Scrofa | GIVEQCCTSICSLYQLENYCN |
| Insulin B chain | B | 30 | Sus Scrofa | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
Experimental Data
Method: NEUTRON DIFFRACTION
Deposited Date: 2008-07-26 Deposition Author(s): Ishikawa, T. , Niimura, N. , Tanaka, I.