2ZP9
The nature of the trap:anti-trap complex
PDB DOI: 10.2210/pdb2zp9/pdb
Classification: RNA BINDING PROTEIN/TRANSCRIPTION Organism(s): Bacillus Stearothermophilus , Bacillus Subtilis
Deposited: 2008-07-08 Deposition Author(s): Akashi, S. , Heddle, J.G. , Park, S.Y. , Tame, J.R.H. , Unzai, S. , Watanabe, M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 3.2 Å
The nature of the trap:anti-trap complex
Akashi, S. , Heddle, J.G. , Park, S.Y. , Tame, J.R.H. , Unzai, S. , Watanabe, M.
Primary Citation of Related Structures: 2ZP9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription attenuation protein mtrB | A | 81 | Bacillus Stearothermophilus , Bacillus Subtilis | MYTNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKKAAAAAAA |
| Transcription attenuation protein mtrB | B | 81 | Bacillus Stearothermophilus , Bacillus Subtilis | MYTNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKKAAAAAAA |
| Transcription attenuation protein mtrB | F | 81 | Bacillus Stearothermophilus , Bacillus Subtilis | MYTNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKKAAAAAAA |
| Transcription attenuation protein mtrB | G | 81 | Bacillus Stearothermophilus , Bacillus Subtilis | MYTNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKKAAAAAAA |
| Transcription attenuation protein mtrB | K | 81 | Bacillus Stearothermophilus , Bacillus Subtilis | MYTNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKKAAAAAAA |
| Transcription attenuation protein mtrB | L | 81 | Bacillus Stearothermophilus , Bacillus Subtilis | MYTNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKKAAAAAAA |
| Tryptophan RNA-binding attenuator protein-inhibitory protein | C | 53 | Bacillus Stearothermophilus , Bacillus Subtilis | MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK |
| Tryptophan RNA-binding attenuator protein-inhibitory protein | D | 53 | Bacillus Stearothermophilus , Bacillus Subtilis | MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK |
| Tryptophan RNA-binding attenuator protein-inhibitory protein | E | 53 | Bacillus Stearothermophilus , Bacillus Subtilis | MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK |
| Tryptophan RNA-binding attenuator protein-inhibitory protein | H | 53 | Bacillus Stearothermophilus , Bacillus Subtilis | MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK |
| Tryptophan RNA-binding attenuator protein-inhibitory protein | I | 53 | Bacillus Stearothermophilus , Bacillus Subtilis | MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK |
| Tryptophan RNA-binding attenuator protein-inhibitory protein | J | 53 | Bacillus Stearothermophilus , Bacillus Subtilis | MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK |
| Tryptophan RNA-binding attenuator protein-inhibitory protein | M | 53 | Bacillus Stearothermophilus , Bacillus Subtilis | MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK |
| Tryptophan RNA-binding attenuator protein-inhibitory protein | N | 53 | Bacillus Stearothermophilus , Bacillus Subtilis | MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK |
| Tryptophan RNA-binding attenuator protein-inhibitory protein | O | 53 | Bacillus Stearothermophilus , Bacillus Subtilis | MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2008-07-08 Deposition Author(s): Akashi, S. , Heddle, J.G. , Park, S.Y. , Tame, J.R.H. , Unzai, S. , Watanabe, M.