The nature of the trap:anti-trap complex
PDB DOI: 10.2210/pdb2zp8/pdb
Classification: RNA BINDING PROTEIN/TRANSCRIPTION Organism(s): Bacillus Stearothermophilus , Bacillus Subtilis
Deposited: 2008-07-08 Deposition Author(s): Akashi, S. , Heddle, J.G. , Park, S.Y. , Tame, J.R.H. , Unzai, S. , Watanabe, M.
The nature of the trap:anti-trap complex
Akashi, S. , Heddle, J.G. , Park, S.Y. , Tame, J.R.H. , Unzai, S. , Watanabe, M.
Primary Citation of Related Structures: 2ZP8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription attenuation protein mtrB | A | 74 | Bacillus Stearothermophilus , Bacillus Subtilis | MYTNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKK |
| Transcription attenuation protein mtrB | B | 74 | Bacillus Stearothermophilus , Bacillus Subtilis | MYTNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKK |
| Transcription attenuation protein mtrB | C | 74 | Bacillus Stearothermophilus , Bacillus Subtilis | MYTNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKK |
| Transcription attenuation protein mtrB | D | 74 | Bacillus Stearothermophilus , Bacillus Subtilis | MYTNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKK |
| Tryptophan RNA-binding attenuator protein-inhibitory protein | E | 53 | Bacillus Stearothermophilus , Bacillus Subtilis | MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK |
| Tryptophan RNA-binding attenuator protein-inhibitory protein | F | 53 | Bacillus Stearothermophilus , Bacillus Subtilis | MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK |
| Tryptophan RNA-binding attenuator protein-inhibitory protein | G | 53 | Bacillus Stearothermophilus , Bacillus Subtilis | MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK |
| Tryptophan RNA-binding attenuator protein-inhibitory protein | H | 53 | Bacillus Stearothermophilus , Bacillus Subtilis | MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK |
| Tryptophan RNA-binding attenuator protein-inhibitory protein | I | 53 | Bacillus Stearothermophilus , Bacillus Subtilis | MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK |
| Tryptophan RNA-binding attenuator protein-inhibitory protein | J | 53 | Bacillus Stearothermophilus , Bacillus Subtilis | MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-07-08 Deposition Author(s): Akashi, S. , Heddle, J.G. , Park, S.Y. , Tame, J.R.H. , Unzai, S. , Watanabe, M.