Crystal structure of bovine insulin (hexameric form)
PDB DOI: 10.2210/pdb2zp6/pdb
Classification: HORMONE Organism(s): Bos Taurus
Deposited: 2008-06-27 Deposition Author(s): Jaimohan, S.M. , Mandal, A.B. , Naresh, M.D.
Crystal structure of bovine insulin (hexameric form)
Jaimohan, S.M. , Mandal, A.B. , Naresh, M.D.
Primary Citation of Related Structures: 2ZP6
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin A chain | A | 21 | Bos Taurus | GIVEQCCASVCSLYQLENYCN |
Insulin A chain | C | 21 | Bos Taurus | GIVEQCCASVCSLYQLENYCN |
Insulin B chain | B | 30 | Bos Taurus | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
Insulin B chain | D | 30 | Bos Taurus | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-06-27 Deposition Author(s): Jaimohan, S.M. , Mandal, A.B. , Naresh, M.D.