Crystal structure of the rat vitamin d receptor ligand binding domain complexed with yr301 and a synthetic peptide containing the nr2 box of drip 205
PDB DOI: 10.2210/pdb2zfx/pdb
Classification: TRANSCRIPTION Organism(s): Rattus Norvegicus , Synthetic Construct
Deposited: 2008-01-15 Deposition Author(s): Kakuda, S. , Takimoto-Kamimura, M.
Crystal structure of the rat vitamin d receptor ligand binding domain complexed with yr301 and a synthetic peptide containing the nr2 box of drip 205
Kakuda, S. , Takimoto-Kamimura, M.
Primary Citation of Related Structures: 2ZFX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Vitamin D3 receptor | A | 265 | Rattus Norvegicus , Synthetic Construct | GSHMLKDSLRPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSVTLDLSPLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGNEIS |
| DRIP 205 NR2 box peptide | C | 13 | Rattus Norvegicus , Synthetic Construct | KNHPMLMNLLKDN |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-01-15 Deposition Author(s): Kakuda, S. , Takimoto-Kamimura, M.