Crystal structure of ttma177, a hypothetical protein from thermus thermophilus phage tma
PDB DOI: 10.2210/pdb2zdj/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Thermus Thermophilus Phage Tma
Deposited: 2007-11-26 Deposition Author(s): Agari, Y. , Ebihara, A. , Kuramitsu, S. , Oshima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shinkai, A. , Tamakoshi, M. , Yamagishi, A. , Yokoyama, S.
Crystal structure of ttma177, a hypothetical protein from thermus thermophilus phage tma
Agari, Y. , Ebihara, A. , Kuramitsu, S. , Oshima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shinkai, A. , Tamakoshi, M. , Yamagishi, A. , Yokoyama, S.
Primary Citation of Related Structures: 2ZDJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| hypothetical protein TTMA177 | A | 69 | Thermus Thermophilus Phage Tma | MKMRKLVKDFGDDYTLIQDSQEVKAILEYIGSEEEPHALFVKVGDGDYEEVWGIDSFVPYNFLEAYRLK |
| hypothetical protein TTMA177 | B | 69 | Thermus Thermophilus Phage Tma | MKMRKLVKDFGDDYTLIQDSQEVKAILEYIGSEEEPHALFVKVGDGDYEEVWGIDSFVPYNFLEAYRLK |
| hypothetical protein TTMA177 | C | 69 | Thermus Thermophilus Phage Tma | MKMRKLVKDFGDDYTLIQDSQEVKAILEYIGSEEEPHALFVKVGDGDYEEVWGIDSFVPYNFLEAYRLK |
| hypothetical protein TTMA177 | D | 69 | Thermus Thermophilus Phage Tma | MKMRKLVKDFGDDYTLIQDSQEVKAILEYIGSEEEPHALFVKVGDGDYEEVWGIDSFVPYNFLEAYRLK |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-11-26 Deposition Author(s): Agari, Y. , Ebihara, A. , Kuramitsu, S. , Oshima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shinkai, A. , Tamakoshi, M. , Yamagishi, A. , Yokoyama, S.