Crystal structure of ph1033 from pyrococcus horikoshii ot3
PDB DOI: 10.2210/pdb2zbn/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Pyrococcus Horikoshii
Deposited: 2007-10-26 Deposition Author(s): Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sugahara, M.
Crystal structure of ph1033 from pyrococcus horikoshii ot3
Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sugahara, M.
Primary Citation of Related Structures: 2ZBN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| UPF0310 protein PH1033 | A | 145 | Pyrococcus Horikoshii | MTYWICITNRENWEVIKRHNVWGVPKKHKNTLSRVKPGDKLVIYVRQEKDKEGNLLEPKIVGIYEVTSEPYVDFSRIFKPHRGGKETYPYRVKIKPIKIGEINFKPLINDLKFIKNKKRWSMHFFGKAMRELPEEDYKLIEKLLL |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-10-26 Deposition Author(s): Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sugahara, M.