Crystal structure of archaeal trna-methylase for position 56 (atrm56) from pyrococcus horikoshii, complexed with s-adenosyl-l-methionine
PDB DOI: 10.2210/pdb2yy8/pdb
Classification: TRANSFERASE Organism(s): Pyrococcus Horikoshii
Deposited: 2007-04-27 Deposition Author(s): Kuratani, M. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Crystal structure of archaeal trna-methylase for position 56 (atrm56) from pyrococcus horikoshii, complexed with s-adenosyl-l-methionine
Kuratani, M. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Primary Citation of Related Structures: 2YY8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| UPF0106 protein PH0461 | A | 201 | Pyrococcus Horikoshii | MIVVLRLGHRPERDKRVTTHVALTARAFGADGIIIASEEDEKVKESVEDVVKRWGGPFFIEFNRNWRKVMKEFTGVKVHLTMYGLHVDDVIEELKEKLKKGEDFMIIVGAEKVPREVYELADYNVAIGNQPHSEVAALAVLLDRLLEGKGLKKEFKGAKIKIVPQARGKKVVEVQGYAEQDKAEGKATPGKNWENHHHHHH |
| UPF0106 protein PH0461 | B | 201 | Pyrococcus Horikoshii | MIVVLRLGHRPERDKRVTTHVALTARAFGADGIIIASEEDEKVKESVEDVVKRWGGPFFIEFNRNWRKVMKEFTGVKVHLTMYGLHVDDVIEELKEKLKKGEDFMIIVGAEKVPREVYELADYNVAIGNQPHSEVAALAVLLDRLLEGKGLKKEFKGAKIKIVPQARGKKVVEVQGYAEQDKAEGKATPGKNWENHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-04-27 Deposition Author(s): Kuratani, M. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.