Solution structure of the sant domain of human swi/snf-related matrix-associated actin-dependent regulator of chromatin subfamily c member 1
PDB DOI: 10.2210/pdb2yus/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2007-04-06 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Satio, K. , Tochio, N. , Yokoyama, S.
Solution structure of the sant domain of human swi/snf-related matrix-associated actin-dependent regulator of chromatin subfamily c member 1
Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Satio, K. , Tochio, N. , Yokoyama, S.
Primary Citation of Related Structures: 2YUS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1 | A | 79 | Homo Sapiens | GSSGSSGTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-04-06 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Satio, K. , Tochio, N. , Yokoyama, S.