Solution structure of the zf-c2h2 domain (669-699aa) in zinc finger protein 473
PDB DOI: 10.2210/pdb2yu5/pdb
Classification: RNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2007-04-05 Deposition Author(s): He, F. , Inoue, M. , Kadirvel, S. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Tarada, T. , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the zf-c2h2 domain (669-699aa) in zinc finger protein 473
He, F. , Inoue, M. , Kadirvel, S. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Tarada, T. , Yokoyama, S.
Primary Citation of Related Structures: 2YU5
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Zinc finger protein 473 | A | 44 | Homo Sapiens | GSSGSSGAGENPFKCSKCDRVFTQRNYLVQHERTHARKSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-04-05 Deposition Author(s): He, F. , Inoue, M. , Kadirvel, S. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Tarada, T. , Yokoyama, S.