2YTG
Solution structure of the c2h2 type zinc finger (region 369-401) of human zinc finger protein 95 homolog
PDB DOI: 10.2210/pdb2ytg/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2007-04-05 Deposition Author(s): Abe, H. , Kigawa, T. , Kobayashi, N. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Sato, M. , Tochio, N. , Tomizawa, T. , Yokoyama, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the c2h2 type zinc finger (region 369-401) of human zinc finger protein 95 homolog
Abe, H. , Kigawa, T. , Kobayashi, N. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Sato, M. , Tochio, N. , Tomizawa, T. , Yokoyama, S.
Primary Citation of Related Structures: 2YTG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger protein 95 homolog | A | 46 | Homo Sapiens | GSSGSSGTGEKPFKCGECGKSYNQRVHLTQHQRVHTGEKPSGPSSG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-04-05 Deposition Author(s): Abe, H. , Kigawa, T. , Kobayashi, N. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Sato, M. , Tochio, N. , Tomizawa, T. , Yokoyama, S.