Solution structure of c2h2 type zinc finger domain 5 in zinc finger protein 32
PDB DOI: 10.2210/pdb2ytb/pdb
Classification: METAL BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2007-04-05 Deposition Author(s): Inoue, M. , Kasahara, N. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Tsuda, K. , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of c2h2 type zinc finger domain 5 in zinc finger protein 32
Inoue, M. , Kasahara, N. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Tsuda, K. , Yokoyama, S.
Primary Citation of Related Structures: 2YTB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger protein 32 | A | 42 | Homo Sapiens | GSSGSSGGEKPYRCDQCGKAFSQKGSLIVHIRVHTGSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-04-05 Deposition Author(s): Inoue, M. , Kasahara, N. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Tsuda, K. , Yokoyama, S.