Solution structure of the phd domain of metal-response element-binding transcription factor 2
PDB DOI: 10.2210/pdb2yt5/pdb
Classification: TRANSCRIPTION Organism(s): Enterobacter Aerogenes
Deposited: 2007-04-05 Deposition Author(s): Harada, T. , Isono, K. , Kigawa, T. , Koseki, H. , Masuda, K. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S.
Solution structure of the phd domain of metal-response element-binding transcription factor 2
Harada, T. , Isono, K. , Kigawa, T. , Koseki, H. , Masuda, K. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S.
Primary Citation of Related Structures: 2YT5
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Metal-response element-binding transcription factor 2 | A | 66 | Enterobacter Aerogenes | GSSGSSGVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKR |
Method: SOLUTION NMR
Deposited Date: 2007-04-05 Deposition Author(s): Harada, T. , Isono, K. , Kigawa, T. , Koseki, H. , Masuda, K. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S.