2YSO
Solution structure of the c2h2 type zinc finger (region 656-688) of human zinc finger protein 95 homolog
PDB DOI: 10.2210/pdb2yso/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Kuwasako, K. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Takahashi, M. , Tanabe, W. , Tochio, N. , Tsuda, K. , Watanabe, S. , Yokoyama, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the c2h2 type zinc finger (region 656-688) of human zinc finger protein 95 homolog
Harada, T. , Kigawa, T. , Kuwasako, K. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Takahashi, M. , Tanabe, W. , Tochio, N. , Tsuda, K. , Watanabe, S. , Yokoyama, S.
Primary Citation of Related Structures: 2YSO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger protein 95 homolog | A | 46 | Homo Sapiens | GSSGSSGSREKSHQCRECGEIFFQYVSLIEHQVLHMGQKNSGPSSG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Kuwasako, K. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Takahashi, M. , Tanabe, W. , Tochio, N. , Tsuda, K. , Watanabe, S. , Yokoyama, S.