Solution structure of the first ww domain from the mouse transcription elongation regulator 1, transcription factor ca150
PDB DOI: 10.2210/pdb2ysi/pdb
Classification: PROTEIN BINDING Organism(s): Mus Musculus
Deposited: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Li, H. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the first ww domain from the mouse transcription elongation regulator 1, transcription factor ca150
Harada, T. , Kigawa, T. , Koshiba, S. , Li, H. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S.
Primary Citation of Related Structures: 2YSI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription elongation regulator 1 | A | 40 | Mus Musculus | GSSGSSGTEEIWVENKTPDGKVYYYNARTRESAWTKPDGV |
Method: SOLUTION NMR
Deposited Date: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Li, H. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S.