2YSF
Solution structure of the fourth ww domain from the human e3 ubiquitin-protein ligase itchy homolog, itch
PDB DOI: 10.2210/pdb2ysf/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica
Deposited: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Li, H. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the fourth ww domain from the human e3 ubiquitin-protein ligase itchy homolog, itch
Harada, T. , Kigawa, T. , Koshiba, S. , Li, H. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S.
Primary Citation of Related Structures: 2YSF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase Itchy homolog | A | 40 | Salmonella Enterica | GSSGSSGLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Li, H. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S.