Solution structure of the zinc finger cchc domain from the human retinoblastoma-binding protein 6 (retinoblastoma-binding q protein 1, rbq-1)
PDB DOI: 10.2210/pdb2ysa/pdb
Classification: METAL BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tochio, N. , Watanabe, S. , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the zinc finger cchc domain from the human retinoblastoma-binding protein 6 (retinoblastoma-binding q protein 1, rbq-1)
Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tochio, N. , Watanabe, S. , Yokoyama, S.
Primary Citation of Related Structures: 2YSA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Retinoblastoma-binding protein 6 | A | 55 | Homo Sapiens | GSSGSSGYTCFRCGKPGHYIKNCPTNGDKNFESGPRIKKSTGIPRSFMMEVKDPN |
Method: SOLUTION NMR
Deposited Date: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tochio, N. , Watanabe, S. , Yokoyama, S.