2YS2
Solution structure of the btk motif of human cytoplasmic tyrosine-protein kinase bmx
PDB DOI: 10.2210/pdb2ys2/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2007-04-03 Deposition Author(s): Abe, H. , Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Tomizawa, T. , Yokoyama, S. , Yoneyama, M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the btk motif of human cytoplasmic tyrosine-protein kinase bmx
Abe, H. , Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Tomizawa, T. , Yokoyama, S. , Yoneyama, M.
Primary Citation of Related Structures: 2YS2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cytoplasmic tyrosine-protein kinase BMX | A | 50 | Homo Sapiens | GSSGSSGNPHLLVKYHSGFFVDGKFLCCQQSCKAAPGCTLWEAYSGPSSG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-04-03 Deposition Author(s): Abe, H. , Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Tomizawa, T. , Yokoyama, S. , Yoneyama, M.