Solution structure of the ph domain of dynamin-2 from human
PDB DOI: 10.2210/pdb2ys1/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tochio, N. , Watanabe, S. , Yokoyama, S.
Solution structure of the ph domain of dynamin-2 from human
Harada, T. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tochio, N. , Watanabe, S. , Yokoyama, S.
Primary Citation of Related Structures: 2YS1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Dynamin-2 | A | 113 | Homo Sapiens | GSSGSSGVIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGV |
Method: SOLUTION NMR
Deposited Date: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tochio, N. , Watanabe, S. , Yokoyama, S.