Solution structure of the somatomedin b domain of human ectonucleotide pyrophosphatase/phosphodiesterase family member
PDB DOI: 10.2210/pdb2ys0/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2007-04-03 Deposition Author(s): Abe, H. , Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sasagawa, A. , Tochio, N. , Tomizawa, T. , Yokoyama, S.
Solution structure of the somatomedin b domain of human ectonucleotide pyrophosphatase/phosphodiesterase family member
Abe, H. , Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sasagawa, A. , Tochio, N. , Tomizawa, T. , Yokoyama, S.
Primary Citation of Related Structures: 2YS0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 | A | 56 | Homo Sapiens | GSSGSSGWTCNKFRCGEKRLTRSLCACSDDCKDQGDCCINYSSVCQGEKSSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-04-03 Deposition Author(s): Abe, H. , Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sasagawa, A. , Tochio, N. , Tomizawa, T. , Yokoyama, S.