Solution structure of the c2h2-type zinc finger domain (699-729) from zinc finger protein 473
PDB DOI: 10.2210/pdb2yrh/pdb
Classification: CELL CYCLE Organism(s): Homo Sapiens
Deposited: 2007-04-02 Deposition Author(s): Hayashi, F. , Qin, X.R. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Solution structure of the c2h2-type zinc finger domain (699-729) from zinc finger protein 473
Hayashi, F. , Qin, X.R. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Primary Citation of Related Structures: 2YRH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger protein 473 | A | 44 | Homo Sapiens | GSSGSSGKKPLVCNECGKTFRQSSCLSKHQRIHSGEKPSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-04-02 Deposition Author(s): Hayashi, F. , Qin, X.R. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.