Solution structure of the b-box domain from tripartite motif-containing protein 5
PDB DOI: 10.2210/pdb2yrg/pdb
Classification: LIGASE Organism(s): Salmonella Enterica
Deposited: 2007-04-02 Deposition Author(s): Hayahsi, F. , Qin, X.R. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Solution structure of the b-box domain from tripartite motif-containing protein 5
Hayahsi, F. , Qin, X.R. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Primary Citation of Related Structures: 2YRG
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Tripartite motif-containing protein 5 | A | 59 | Salmonella Enterica | GSSGSSGSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFPTSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-04-02 Deposition Author(s): Hayahsi, F. , Qin, X.R. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.