Solution structure of the kh domain in kiaa0907 protein
PDB DOI: 10.2210/pdb2yqr/pdb
Classification: RNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2007-03-30 Deposition Author(s): He, F. , Inoue, M. , Kadirvel, S. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Tarada, T. , Yokoyama, S.
Solution structure of the kh domain in kiaa0907 protein
He, F. , Inoue, M. , Kadirvel, S. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Tarada, T. , Yokoyama, S.
Primary Citation of Related Structures: 2YQR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| KIAA0907 protein | A | 119 | Homo Sapiens | GSSGSSGGMHYVQDKLFVGLEHAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISHPKPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPG |
Method: SOLUTION NMR
Deposited Date: 2007-03-30 Deposition Author(s): He, F. , Inoue, M. , Kadirvel, S. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Tarada, T. , Yokoyama, S.