Solution structure of the zf-hit domain in zinc finger hit domain-containing protein 3 (trip-3)
PDB DOI: 10.2210/pdb2yqq/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2007-03-30 Deposition Author(s): He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Suzuki, S. , Terada, T. , Yokoyama, S.
Solution structure of the zf-hit domain in zinc finger hit domain-containing protein 3 (trip-3)
He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Suzuki, S. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 2YQQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger HIT domain-containing protein 3 | A | 56 | Homo Sapiens | GSSGSSGLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-03-30 Deposition Author(s): He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Suzuki, S. , Terada, T. , Yokoyama, S.