2YPB
Structure of the scl:e47 complex bound to dna
PDB DOI: 10.2210/pdb2ypb/pdb
Classification: IMMUNE SYSTEM Organism(s): Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-10-30 Deposition Author(s): El Omari, K. , Hoosdally, S.J. , Karia, D. , Mancini, E.J. , Patient, R. , Platonova, O. , Ponsele, E. , Porcher, C. , Tuladhar, K. , Vyas, P.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.87 Å
Structure of the scl:e47 complex bound to dna
El Omari, K. , Hoosdally, S.J. , Karia, D. , Mancini, E.J. , Patient, R. , Platonova, O. , Ponsele, E. , Porcher, C. , Tuladhar, K. , Vyas, P.
Primary Citation of Related Structures: 2YPB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| T-CELL ACUTE LYMPHOCYTIC LEUKEMIA PROTEIN 1 | A | 91 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGSSHHHHHHSQDPEISDGPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQR |
| TRANSCRIPTION FACTOR E2-ALPHA | B | 82 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MADLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLNPKAA |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2012-10-30 Deposition Author(s): El Omari, K. , Hoosdally, S.J. , Karia, D. , Mancini, E.J. , Patient, R. , Platonova, O. , Ponsele, E. , Porcher, C. , Tuladhar, K. , Vyas, P.