Triazolopyridine inhibitors of p38 kinase
PDB DOI: 10.2210/pdb2yiw/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2011-05-17 Deposition Author(s): Anderson, M. , Bunnage, M.E. , Burrows, J.L. , Butcher, K.J. , Dodd, P.G. , Evans, T.J. , Fairman, D.A. , Hughes, S.J. , Irving, S.L. , Kilty, I.C. , Lemaitre, A. , Lewthwaite, R.A. , Mahnke, A. , Mathais, J.P. , Millan, D.S. , Philip, J. , Phillips, C. , Smith, R.T. , Stefamiak, M.H. , Yeadon, M.
Triazolopyridine inhibitors of p38 kinase
Anderson, M. , Bunnage, M.E. , Burrows, J.L. , Butcher, K.J. , Dodd, P.G. , Evans, T.J. , Fairman, D.A. , Hughes, S.J. , Irving, S.L. , Kilty, I.C. , Lemaitre, A. , Lewthwaite, R.A. , Mahnke, A. , Mathais, J.P. , Millan, D.S. , Philip, J. , Phillips, C. , Smith, R.T. , Stefamiak, M.H. , Yeadon, M.
Primary Citation of Related Structures: 2YIW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| MITOGEN-ACTIVATED PROTEIN KINASE 14 | A | 359 | Homo Sapiens | SQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-05-17 Deposition Author(s): Anderson, M. , Bunnage, M.E. , Burrows, J.L. , Butcher, K.J. , Dodd, P.G. , Evans, T.J. , Fairman, D.A. , Hughes, S.J. , Irving, S.L. , Kilty, I.C. , Lemaitre, A. , Lewthwaite, R.A. , Mahnke, A. , Mathais, J.P. , Millan, D.S. , Philip, J. , Phillips, C. , Smith, R.T. , Stefamiak, M.H. , Yeadon, M.