Hiv-1 inhibitors with a tertiary-alcohol-containing transition-state mimic and various p2 and p1 prime substituents
PDB DOI: 10.2210/pdb2xyf/pdb
Classification: HYDROLASE Organism(s): Human Immunodeficiency Virus 1 (Z2/Cdc-Z34 Isolate)
Deposited: 2010-11-17 Deposition Author(s): Ekegren, J.K. , Larhed, M. , Ohrngren, P. , Persson, M. , Rosenquist, A. , Samuelsson, B. , Unge, T. , Wallberg, H. , Wu, X.
Hiv-1 inhibitors with a tertiary-alcohol-containing transition-state mimic and various p2 and p1 prime substituents
Ekegren, J.K. , Larhed, M. , Ohrngren, P. , Persson, M. , Rosenquist, A. , Samuelsson, B. , Unge, T. , Wallberg, H. , Wu, X.
Primary Citation of Related Structures: 2XYF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEASE | A | 99 | Human Immunodeficiency Virus 1 (Z2/Cdc-Z34 Isolate) | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF |
| PROTEASE | B | 99 | Human Immunodeficiency Virus 1 (Z2/Cdc-Z34 Isolate) | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-11-17 Deposition Author(s): Ekegren, J.K. , Larhed, M. , Ohrngren, P. , Persson, M. , Rosenquist, A. , Samuelsson, B. , Unge, T. , Wallberg, H. , Wu, X.