Molecular and structural basis of escrt-iii recruitment to membranes during archaeal cell division
PDB DOI: 10.2210/pdb2xvc/pdb
Classification: CELL CYCLE Organism(s): Chaetomium Thermophilum Var. Thermophilum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-10-25 Deposition Author(s): Bell, S.D. , Chong, P.L. , Hodgson, B. , Obita, T. , Samson, R.Y. , Shaw, M.K. , Williams, R.L.
Molecular and structural basis of escrt-iii recruitment to membranes during archaeal cell division
Bell, S.D. , Chong, P.L. , Hodgson, B. , Obita, T. , Samson, R.Y. , Shaw, M.K. , Williams, R.L.
Primary Citation of Related Structures: 2XVC
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
ESCRT-III | A | 59 | Chaetomium Thermophilum Var. Thermophilum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MAHHHHHHMITERELLDYIVNNGGFLDIEHFSKVYGVEKQEVVKLLEALKNKGLIAVES |
CDVA, SSO0911 | B | 15 | Chaetomium Thermophilum Var. Thermophilum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SEIPLPIPVKVINTL |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-10-25 Deposition Author(s): Bell, S.D. , Chong, P.L. , Hodgson, B. , Obita, T. , Samson, R.Y. , Shaw, M.K. , Williams, R.L.