Bovine trypsin in complex with evolutionary enhanced schistocerca gregaria protease inhibitor 1 (sgpi-1-p02)
PDB DOI: 10.2210/pdb2xtt/pdb
Classification: HYDROLASE Organism(s): Bos Taurus , Synthetic Construct
Deposited: 2010-10-12 Deposition Author(s): Graf, L. , Kardos, J. , Katona, G. , Pal, G. , Patthy, A. , Porrogi, P. , Szenthe, B. , Wahlgren, W.Y.
Bovine trypsin in complex with evolutionary enhanced schistocerca gregaria protease inhibitor 1 (sgpi-1-p02)
Graf, L. , Kardos, J. , Katona, G. , Pal, G. , Patthy, A. , Porrogi, P. , Szenthe, B. , Wahlgren, W.Y.
Primary Citation of Related Structures: 2XTT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEASE INHIBITOR SGPI-1 | A | 36 | Bos Taurus , Synthetic Construct | EQECEPGQTKKQDCNTCRCGSDGVWACTRMGCPPHA |
| CATIONIC TRYPSIN | B | 223 | Bos Taurus , Synthetic Construct | IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-10-12 Deposition Author(s): Graf, L. , Kardos, J. , Katona, G. , Pal, G. , Patthy, A. , Porrogi, P. , Szenthe, B. , Wahlgren, W.Y.