Structure of peridinin-chlorophyll-protein reconstituted with bchl-a
PDB DOI: 10.2210/pdb2x21/pdb
Classification: PHOTOSYNTHESIS Organism(s): Amphidinium Carterae
Deposited: 2010-01-09 Deposition Author(s): Hiller, R.G. , Hofmann, E. , Schulte, T.
Structure of peridinin-chlorophyll-protein reconstituted with bchl-a
Hiller, R.G. , Hofmann, E. , Schulte, T.
Primary Citation of Related Structures: 2X21
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PERIDININ-CHLOROPHYLL A-BINDING PROTEIN, CHLOROPLASTIC | M | 151 | Amphidinium Carterae | ADEIGDAAKKLGDASYAFAKEVDWNNGIFLQAPGKLQPLEALKAIDKMIVMGAAADPKLLKAAAEAHHKAIGSVSGPNGVTSRADWDSVNAALGRVIASVPENMVMDVYDSVSKITDPKVPAYMKSLVNGADAEKAYEGFLAFKDVVKKSQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-01-09 Deposition Author(s): Hiller, R.G. , Hofmann, E. , Schulte, T.