Molecular architecture of the stressosome, a signal integration and transduction hub
PDB DOI: 10.2210/pdb2vy9/pdb
Classification: GENE REGULATION Organism(s): Moorella Thermoacetica
Deposited: 2008-07-21 Deposition Author(s): Delumeau, O. , Firbank, S.J. , Grant, T. , Lewis, P.J. , Lewis, R.J. , Marles-Wright, J. , Murray, J.W. , Newman, J.A. , Quin, M.B. , Race, P.R. , Rohou, A. , Tichelaar, W. , Van Duinen, G. , Van Heel, M.
Molecular architecture of the stressosome, a signal integration and transduction hub
Delumeau, O. , Firbank, S.J. , Grant, T. , Lewis, P.J. , Lewis, R.J. , Marles-Wright, J. , Murray, J.W. , Newman, J.A. , Quin, M.B. , Race, P.R. , Rohou, A. , Tichelaar, W. , Van Duinen, G. , Van Heel, M.
Primary Citation of Related Structures: 2VY9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ANTI-SIGMA-FACTOR ANTAGONIST | A | 123 | Moorella Thermoacetica | MSSRVPILKVDDYWVVAIEETLHDQSVIQFKEELLHNITGVAGKGLVIDISALEVVDSFVTRVLIEISRLAELLGLPFVLTGIKPAVAITLTEMGLDLRGMATALNLQKGLDKLKNLARMEQR |
| ANTI-SIGMA-FACTOR ANTAGONIST | B | 123 | Moorella Thermoacetica | MSSRVPILKVDDYWVVAIEETLHDQSVIQFKEELLHNITGVAGKGLVIDISALEVVDSFVTRVLIEISRLAELLGLPFVLTGIKPAVAITLTEMGLDLRGMATALNLQKGLDKLKNLARMEQR |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-07-21 Deposition Author(s): Delumeau, O. , Firbank, S.J. , Grant, T. , Lewis, P.J. , Lewis, R.J. , Marles-Wright, J. , Murray, J.W. , Newman, J.A. , Quin, M.B. , Race, P.R. , Rohou, A. , Tichelaar, W. , Van Duinen, G. , Van Heel, M.