Advanced Search:
2VNN
Human bace-1 in complex with 7-ethyl-n-((1s,2r)-2-hydroxy-1-(phenylmethyl)-3-(((3-(trifluoromethyl)phenyl)methyl)amino)propyl)-1- methyl-3,4-dihydro-1h-(1,2,5)thiadiazepino(3,4,5-hi)indole-9- carboxamide 2,2-dioxide
PDB DOI: 10.2210/pdb2vnn/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2008-02-05 Deposition Author(s): Charrier, N. , Clarke, B. , Cutler, L. , Demont, E. , Dingwall, C. , Dunsdon, R. , East, P. , Hawkins, J. , Howes, C. , Hussain, I. , Jeffrey, P. , Maile, G. , Matico, R. , Mosley, J. , Naylor, A. , Obrien, A. , Redshaw, S. , Rowland, P. , Smith, K.J. , Soleil, V. , Sweitzer, S. , Theobald, P. , Vesey, D. , Walter, D.S. , Wayne, G.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.87 Å
Human bace-1 in complex with 7-ethyl-n-((1s,2r)-2-hydroxy-1-(phenylmethyl)-3-(((3-(trifluoromethyl)phenyl)methyl)amino)propyl)-1- methyl-3,4-dihydro-1h-(1,2,5)thiadiazepino(3,4,5-hi)indole-9- carboxamide 2,2-dioxide
Charrier, N. , Clarke, B. , Cutler, L. , Demont, E. , Dingwall, C. , Dunsdon, R. , East, P. , Hawkins, J. , Howes, C. , Hussain, I. , Jeffrey, P. , Maile, G. , Matico, R. , Mosley, J. , Naylor, A. , Obrien, A. , Redshaw, S. , Rowland, P. , Smith, K.J. , Soleil, V. , Sweitzer, S. , Theobald, P. , Vesey, D. , Walter, D.S. , Wayne, G.
Primary Citation of Related Structures: 2VNN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| BETA-SECRETASE 1 | A | 392 | Homo Sapiens | VEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPQVTVRANIAAITESDKFFIQGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLQQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTQQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDE |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2008-02-05 Deposition Author(s): Charrier, N. , Clarke, B. , Cutler, L. , Demont, E. , Dingwall, C. , Dunsdon, R. , East, P. , Hawkins, J. , Howes, C. , Hussain, I. , Jeffrey, P. , Maile, G. , Matico, R. , Mosley, J. , Naylor, A. , Obrien, A. , Redshaw, S. , Rowland, P. , Smith, K.J. , Soleil, V. , Sweitzer, S. , Theobald, P. , Vesey, D. , Walter, D.S. , Wayne, G.