Crystal structure of radiation-induced myoglobin compound ii generated after annealing of peroxymyoglobin
PDB DOI: 10.2210/pdb2vm0/pdb
Classification: OXYGEN TRANSPORT Organism(s): Equus Caballus
Deposited: 2008-01-20 Deposition Author(s): Andersson, K.K. , Gorbitz, C.H. , Hersleth, H.-P.
Crystal structure of radiation-induced myoglobin compound ii generated after annealing of peroxymyoglobin
Andersson, K.K. , Gorbitz, C.H. , Hersleth, H.-P.
Primary Citation of Related Structures: 2VM0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| MYOGLOBIN | A | 153 | Equus Caballus | GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQG |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-01-20 Deposition Author(s): Andersson, K.K. , Gorbitz, C.H. , Hersleth, H.-P.