Yeast sho1 sh3 domain complexed with a peptide from pbs2
PDB DOI: 10.2210/pdb2vkn/pdb
Classification: MEMBRANE PROTEIN Organism(s): Sesbania Mosaic Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2007-12-20 Deposition Author(s): Kursula, I. , Kursula, P. , Paraskevopoulos, K. , Song, Y.H. , Wilmanns, M.
Yeast sho1 sh3 domain complexed with a peptide from pbs2
Kursula, I. , Kursula, P. , Paraskevopoulos, K. , Song, Y.H. , Wilmanns, M.
Primary Citation of Related Structures: 2VKN
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
PROTEIN SSU81 | A | 70 | Sesbania Mosaic Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DDNFIYKAKALYPYDADDDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQLIDGPEEMHR |
MAP KINASE KINASE PBS2 | C | 12 | Sesbania Mosaic Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | NKPLPPLPLAGS |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-12-20 Deposition Author(s): Kursula, I. , Kursula, P. , Paraskevopoulos, K. , Song, Y.H. , Wilmanns, M.