2VJ7
Human bace-1 in complex with 3-(ethylamino)-n-((1s,2r)-2-hydroxy-1-(phenylmethyl)-3-(((3-(trifluoromethyl)phenyl)methyl)amino)propyl)-5-(2-oxo-1-pyrrolidinyl)benzamide
PDB DOI: 10.2210/pdb2vj7/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2007-12-06 Deposition Author(s): Clarke, B. , Demont, E. , Dingwall, C. , Dunsdon, R. , Faller, A. , Hawkins, J. , Hussain, I. , Macpherson, D. , Maile, G. , Matico, R. , Milner, P. , Mosley, J. , Naylor, A. , O'Brien, A. , Redshaw, S. , Riddell, D. , Rowland, P. , Smith, K. , Soleil, V. , Stanway, S. , Stemp, G. , Sweitzer, S. , Theobald, P. , Vesey, D. , Walter, D.S. , Ward, J. , Wayne, G.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.6 Å
Human bace-1 in complex with 3-(ethylamino)-n-((1s,2r)-2-hydroxy-1-(phenylmethyl)-3-(((3-(trifluoromethyl)phenyl)methyl)amino)propyl)-5-(2-oxo-1-pyrrolidinyl)benzamide
Clarke, B. , Demont, E. , Dingwall, C. , Dunsdon, R. , Faller, A. , Hawkins, J. , Hussain, I. , Macpherson, D. , Maile, G. , Matico, R. , Milner, P. , Mosley, J. , Naylor, A. , O'Brien, A. , Redshaw, S. , Riddell, D. , Rowland, P. , Smith, K. , Soleil, V. , Stanway, S. , Stemp, G. , Sweitzer, S. , Theobald, P. , Vesey, D. , Walter, D.S. , Ward, J. , Wayne, G.
Primary Citation of Related Structures: 2VJ7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| BETA-SECRETASE 1 | A | 392 | Homo Sapiens | VEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPQVTVRANIAAITESDKFFIQGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLQQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTQQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDE |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2007-12-06 Deposition Author(s): Clarke, B. , Demont, E. , Dingwall, C. , Dunsdon, R. , Faller, A. , Hawkins, J. , Hussain, I. , Macpherson, D. , Maile, G. , Matico, R. , Milner, P. , Mosley, J. , Naylor, A. , O'Brien, A. , Redshaw, S. , Riddell, D. , Rowland, P. , Smith, K. , Soleil, V. , Stanway, S. , Stemp, G. , Sweitzer, S. , Theobald, P. , Vesey, D. , Walter, D.S. , Ward, J. , Wayne, G.