Human bace-1 in complex with n-((1s,2r)-3-(((1s)-2-(cyclohexylamino)- 1-methyl-2-oxoethyl)amino)-2-hydroxy-1-(phenylmethyl)propyl)-3-(2-oxo- 1-pyrrolidinyl)-5-(propyloxy)benzamide
PDB DOI: 10.2210/pdb2viz/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2007-12-06 Deposition Author(s): Clarke, B. , Demont, E. , Dingwall, C. , Dunsdon, R. , Faller, A. , Hawkins, J. , Hussain, I. , Macpherson, D. , Maile, G. , Matico, R. , Milner, P. , Mosley, J. , Naylor, A. , O'Brien, A. , Redshaw, S. , Riddell, D. , Rowland, P. , Smith, K. , Soleil, V. , Stanway, S. , Stemp, G. , Sweitzer, S. , Theobald, P. , Vesey, D. , Walter, D.S. , Ward, J. , Wayne, G.
Method: X-RAY DIFFRACTION Resolution: 1.6 Å
Human bace-1 in complex with n-((1s,2r)-3-(((1s)-2-(cyclohexylamino)- 1-methyl-2-oxoethyl)amino)-2-hydroxy-1-(phenylmethyl)propyl)-3-(2-oxo- 1-pyrrolidinyl)-5-(propyloxy)benzamide
Clarke, B. , Demont, E. , Dingwall, C. , Dunsdon, R. , Faller, A. , Hawkins, J. , Hussain, I. , Macpherson, D. , Maile, G. , Matico, R. , Milner, P. , Mosley, J. , Naylor, A. , O'Brien, A. , Redshaw, S. , Riddell, D. , Rowland, P. , Smith, K. , Soleil, V. , Stanway, S. , Stemp, G. , Sweitzer, S. , Theobald, P. , Vesey, D. , Walter, D.S. , Ward, J. , Wayne, G.
Primary Citation of Related Structures: 2VIZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| BETA-SECRETASE 1 | A | 392 | Homo Sapiens | VEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPQVTVRANIAAITESDKFFIQGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLQQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTQQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDE |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-12-06 Deposition Author(s): Clarke, B. , Demont, E. , Dingwall, C. , Dunsdon, R. , Faller, A. , Hawkins, J. , Hussain, I. , Macpherson, D. , Maile, G. , Matico, R. , Milner, P. , Mosley, J. , Naylor, A. , O'Brien, A. , Redshaw, S. , Riddell, D. , Rowland, P. , Smith, K. , Soleil, V. , Stanway, S. , Stemp, G. , Sweitzer, S. , Theobald, P. , Vesey, D. , Walter, D.S. , Ward, J. , Wayne, G.