Fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
PDB DOI: 10.2210/pdb2vin/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2007-12-05 Deposition Author(s): Callaghan, O. , Chessari, G. , Congreve, M. , Cowan, S.R. , Frederickson, M. , Matthews, J.E. , Mcmenamin, R. , Smith, D. , Vinkovic, M. , Wallis, N.G.
Fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
Callaghan, O. , Chessari, G. , Congreve, M. , Cowan, S.R. , Frederickson, M. , Matthews, J.E. , Mcmenamin, R. , Smith, D. , Vinkovic, M. , Wallis, N.G.
Primary Citation of Related Structures: 2VIN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| UROKINASE-TYPE PLASMINOGEN ACTIVATOR CHAIN B | A | 253 | Homo Sapiens | IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-12-05 Deposition Author(s): Callaghan, O. , Chessari, G. , Congreve, M. , Cowan, S.R. , Frederickson, M. , Matthews, J.E. , Mcmenamin, R. , Smith, D. , Vinkovic, M. , Wallis, N.G.