Crystal structure of rag2-phd finger in complex with h3r2me2sk4me3 peptide
PDB DOI: 10.2210/pdb2v87/pdb
Classification: PROTEIN BINDING Organism(s): Lucilia Cuprina , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2007-08-02 Deposition Author(s): Ramon-Maiques, S. , Yang, W.
Crystal structure of rag2-phd finger in complex with h3r2me2sk4me3 peptide
Primary Citation of Related Structures: 2V87
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
VDJ RECOMBINATION-ACTIVATING PROTEIN 2 | A | 82 | Lucilia Cuprina , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA |
VDJ RECOMBINATION-ACTIVATING PROTEIN 2 | B | 82 | Lucilia Cuprina , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA |
HISTONE H3.2 | D | 13 | Lucilia Cuprina , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKSTGG |
HISTONE H3.2 | E | 13 | Lucilia Cuprina , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKSTGG |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-08-02 Deposition Author(s): Ramon-Maiques, S. , Yang, W.