Solution structure of the fkbp-domain of legionella pneumophila mip
PDB DOI: 10.2210/pdb2uz5/pdb
Classification: ISOMERASE Organism(s): Legionella Pneumophila
Deposited: 2007-04-25 Deposition Author(s): Ceymann, A. , Ehses, P. , Faber, C. , Fischer, G. , Hacker, J. , Horstmann, M. , Kamphausen, T. , Rosch, P. , Schweimer, K. , Steinert, M.
Solution structure of the fkbp-domain of legionella pneumophila mip
Ceymann, A. , Ehses, P. , Faber, C. , Fischer, G. , Hacker, J. , Horstmann, M. , Kamphausen, T. , Rosch, P. , Schweimer, K. , Steinert, M.
Primary Citation of Related Structures: 2UZ5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| MACROPHAGE INFECTIVITY POTENTIATOR | A | 137 | Legionella Pneumophila | FNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS |
Method: SOLUTION NMR
Deposited Date: 2007-04-25 Deposition Author(s): Ceymann, A. , Ehses, P. , Faber, C. , Fischer, G. , Hacker, J. , Horstmann, M. , Kamphausen, T. , Rosch, P. , Schweimer, K. , Steinert, M.